General Information

  • ID:  hor007213
  • Uniprot ID:  Q8IU54??21-200)
  • Protein name:  Interferon lambda-1
  • Gene name:  NA
  • Organism:  Homo sapiens
  • Family:  Lambda interferon family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0032003 interleukin-28 receptor binding; GO:0005102 signaling receptor binding; GO:0005125 cytokine activity
  • GO CC:  GO:0002829 negative regulation of type 2 immune response; GO:0007259 cell surface receptor signaling pathway via JAK-STAT; GO:0098586 cellular response to virus; GO:0051607 defense response to virus; GO:0045581 negative regulation of T cell differentiation; GO:0045087 innate immune response; GO:0038196 type III interferon-mediated signaling pathway; GO:0032729 positive regulation of type II interferon production; GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein; GO:0045345 positive regulation of MHC class I biosynthetic process; GO:0008285 negative regulation of cell population proliferation; GO:0045892 negative regulation of DNA-templated transcription; GO:0050778 positive regulation of immune response; GO:0032696 negative regulation of interleukin-13 production; GO:0032714 negative regulation of interleukin-5 production; GO:0045893 positive regulation of DNA-templated transcription; GO:0043381 negative regulation of memory T cell differentiation; GO:0046427

Sequence Information

  • Sequence:  PVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
  • Length:  180
  • Propeptide:  MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
  • Signal peptide:  MAAAWTVVLVTLVLGLAVA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA